PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G089800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 270aa    MW: 30956.4 Da    PI: 7.5925
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G089800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.94e-27192241251
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                         +r++W++eLH+rFvea++ LGG+e+AtPk+i++lm+v+gLt+++vkSHLQ
  Gorai.001G089800.1 192 NRRCWSSELHSRFVEALNMLGGNEVATPKQIRDLMQVEGLTIDQVKSHLQ 241
                         79************************************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.639188248IPR017930Myb domain
SuperFamilySSF466892.33E-14189244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-22190241IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-23191245IPR006447Myb domain, plants
PfamPF002491.9E-6193241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MNPNSVELSL SLKPLYVPKS LSSLFLDLSK IDSQYYKLSV LSDYIGKLEE ELARVQPLKH  60
LLPQCTLLLM EAIETLKVEF TNIKNNLKNN EKEGERETQK IISTCSATEE HYGNSQPCNE  120
KGNNMEGLMM AYKENSTWNC VGASSSSGKE KEVAAIDEYS WRNDETFYCN YDHHHHHHHH  180
LKPLTQPIWK NNRRCWSSEL HSRFVEALNM LGGNEVATPK QIRDLMQVEG LTIDQVKSHL  240
QVKFNLLSLI NNNACIILYI VPKKIRNKK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6638851e-114JN663885.1 Gossypium hirsutum microsatellite DPL511 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434799.10.0PREDICTED: uncharacterized protein LOC105761504, partial
TrEMBLA0A0D2PWP81e-160A0A0D2PWP8_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15410716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-20G2-like family protein